Plant Transcription Factor Database
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family GRAS
Protein Properties Length: 389aa    MW: 42529.5 Da    PI: 7.0271
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
                          GRAS  22 alLarlselaspdgd.pmqRlaayfteALaarlarsvselykalppsetseknsseelaalkl.fsevsPilkfshltaNq 100
                                   a+L+ ls   s +gd ++qR++  f+eAL+++ ++  ++l+ +l+ +   +  ++  +++ +  f  ++P+++++  +aN+  70 AALQYLSSVMSFAGDvALQRVVVAFAEALERHAMQLLPGLAWSLQLKVLLPPPTAAYINSAQWsFAMLFPLIRLAAAAANN 150
                                   68999999999999549************************99988776666666666665555***************** PP

                          GRAS 101 aIleavegeervHiiDfd 118
                                   +I ea+  e+rvH++D++ 151 TIKEATPAEHRVHVVDLG 168
                                   ****************97 PP

                          GRAS 149 spesgskeeleetgerLakfAeelgvpfefnvl..vakrledleleeLrvkp..gEalaVnlvlqlhrll........... 214
                                   +p+++++  l++ +  L++ A +l+vp+ fn++  + +r+   ++ +L v +  gEal++ + lq h+l      171 NPNHEDQSFLSQAAGVLTQEAVRLHVPVVFNPVqdHIDRFIPASVAALGVAQgrGEALVITSTLQFHHLIadkvtedlpak 251
                                   5566788889999999****************755555666669999***9999*************************** PP

                          GRAS 215 ..............desvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpresee 281
                                                   s++++ + d++L+++ +l Pk++v++eq a hn+e + +r+ +a++yy +lf  le   + + 252 shskkrknmdtttaTTSHEIT-KADALLRVLCDLTPKLMVLTEQYAYHNGEVLSNRVRNAFDYYEVLFRDLEDA-GGDPMM 330
                                   *********988644444444.59***********************************************887.68889* PP

                          GRAS 282 rikvErellgreivnvvacegaerrerhetlekWrerlee 321
                                   r  v ++ll++e++n+++cega++rerhe+le W  r+++ 331 RGLVQHMLLKEELMNIISCEGAQHRERHENLEYWLPRMMR 370
                                   **********************************999986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098515.90822389IPR005202Transcription factor GRAS
PfamPF035144.1E-1170168IPR005202Transcription factor GRAS
PfamPF035141.3E-26171370IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 389 aa     Download sequence    Send to blast
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002439698.13e-80hypothetical protein SORBIDRAFT_09g018540
TrEMBLK3ZDF12e-86K3ZDF1_SETIT; Uncharacterized protein
STRINGSi024587m5e-86(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G50420.12e-30scarecrow-like 3